<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
TK2021 TK2021 Denmark 2002 HIV1 A Plasma None

Treatment History
Order Regimen Weeks
1 3TC+ AZT+ NFV 88
2 3TC+ AZT+ EFV 85

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    I13V, I15V, E35D, M36I, R41K, R57RK, H69K, K70R, L89M  
>TK2021| codons 1-99
PQITLWQRPLVTVKVGGQLKEALLDTGADDTVLEDINLPGKWKPKMIGGIGGFIKVKQYD
QILIEICGKRAIGTVLVGPTPVNIIGRNMLTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M184V   K103N P225PH, K238KT V35T, E40D, K122E, D123S, I135T, K173S, Q174K, D177E, V179I, V189VI, I202V, Q207A, R211S, F214L, V245E, D250E, L283I, V292I, I293V, E312N Q23QH
>TK2021| codons 1-320
PISPIETVPVKLKPGMDGPKVKHWPLTEEKIKALTEICTDMEKEGKISKIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKNKSVTVLDVGDAYFSVPL
DESFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRSKNPEIII
YQYVDDLYIGSDLEIGQHRTKVEELRAHLLSWGLTTPDKKHQKEHPFLWMGYELHPDTWT
VQPIELPEKESWTVNDIQKLVGKLNWASQIYAGIKVKQLCKLIRGTKALTEIVPLTEEAE
LELAENREILKNPVHGVYYD

References
Author Title Citation
Non-B Workgroup Impact of HIV-1 subtype and antiretroviral therapy on protease and reverse transcriptase genotype: Results of a global collaboration. PLoS Med, 2005