<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
TK2018 TK2018 Denmark 2001 HIV1 C Plasma None

Treatment History
Order Regimen Weeks
1 AZT 87
2 None 87
3 3TC+ AZT+ IDV 34
4 D4T+ DDI+ RTV 13
5 D4T+ DDI 47
6 D4T+ DDI+ NFV+ NVP 61
7 NFV+ NVP+ 3TC+ ABC 110

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46MI, L90M   T12S, I13V, I15V, L19I, K20T, M36I, N37S, R41K, H69K, L89I, I93L  
>TK2018| codons 1-99
PQITLWQRPLVSVKVGGQITEALLDTGADDTVLEEISLPGKWKPKIIGGIGGFIKVRQYD
QILIEICGKKAIGTVLVGPTPVNIIGRNIMTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
D67N, K70R, M184V, T215Y K219E Y181C A98G E28X, V35LM, T39E, S48T, K49R, K122E, D123G, I135T, K173A, D177E, V179I, T200A, I202V, Q207D, R211K, V245Q, A272P, K277R, E291D, V292I, I293V  
>TK2018| codons 1-324
PISPIETVPVKLKPGMDGPKVKQWPLTXEKIKALLEICEEMEKEGKITRIGPENPYNTPV
FAIKKKNSTRWRKLVDFRELNKRTQDFWEVQLGIPHPGGLKKKKSVTVLDVGDAYFSVPL
DEGFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRAQNPEIII
CQYVDDLYVGSDLEIGQHRAKVEELRDHLLKWGFYTPDEKHQKEPPFLWMGYELHPDKWT
VQPIQLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLCKLLRGTKALTDIVPLTEEAE
LELAENREILKEPVHGVYYDPSKD

References
Author Title Citation
Non-B Workgroup Impact of HIV-1 subtype and antiretroviral therapy on protease and reverse transcriptase genotype: Results of a global collaboration. PLoS Med, 2005