<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
TK2015 TK2015 Denmark 2002 HIV1 C Plasma None

Treatment History
Order Regimen Weeks
1 3TC+ AZT+ RTV 107
2 None 1
3 3TC+ D4T+ NFV+ NVP 178
4 None 3

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M184V       P4S, V35T, E36A, T39D, S48T, K122E, D123G, S162Y, K173A, Q174K, D177E, V179I, I195L, G196M, T200A, Q207E, R211K, P225PL, V245Q, D250DE, A272P, E291D, V317A, D320X, P321X, S322SL, K323X  
>TK2015| codons 1-324
PISSIETVPVKLKPGMDGPKVKQWPLTEEKIKALTAICDEMEKEGKITKIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DEGFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQYSMTKILEPFRAKNPEIII
YQYVDDLYVGSDLELMQHRAKIEELREHLLKWGFTTPDKKHQKELPFLWMGYELHPDKWT
VQPIQLPEKESWTVNDIQKLVGKLNWASQIYPGIKVKQLCKLLRGTKALTDVIPLTEEAE
LELAENREILKEPVHGAYYXXLXD

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    L10LV, I15V, L19I, M36I, R41K, H69K, I93L  
>TK2015| codons 1-99
PQITLWQRPVVTIKVGGQIKEALLDTGADDTVLEEINLPGKWKPKMIGGIGGFIKVRQYD
QILIEICGKKAIGTVLVGPTPVNIIGRNLLTQLGCTLNF

References
Author Title Citation
Non-B Workgroup Impact of HIV-1 subtype and antiretroviral therapy on protease and reverse transcriptase genotype: Results of a global collaboration. PLoS Med, 2005