<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
TK2014 TK2014 Denmark 2001 HIV1 D Plasma None

Treatment History
Order Regimen Weeks
1 AZT 4
2 AZT+ DDC+ DDI+ SQV+ 3TC+ RTV 52
3 AZT+ 3TC+ RTV 21
4 AZT+ 3TC+ RTV+ IDV+ SQV 8
5 3TC+ RTV+ D4T+ SQV 35
6 ABC+ DDI+ NFV+ NVP 112
7 DDI+ 3TC+ D4T+ EFV+ IDV+ RTV 79

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46L, I54V, V82A   L10V, R41K, D60E, L63P, I66IF, A71V, T74S, V77I  
>TK2014| codons 1-99
PQITLWQRPVVTIKIGGQLKEALLDTGADDTVLEEMNLPGKWKPKLIGGIGGFVKVRQYE
QIPIEFCGHKVIGSVLIGPTPANIIGRNLLTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, L74V, V75M, M184V, L210W, T215Y K219N K103N, Y181C   A33AP, V35T, K49R, V60I, S68G, T69TI, D121Y, K122E, I135M, S162D, S163SN, D177E, I178L, V179I, Q207E, R211K, P243S, V245K, A272P, L282C, T286A, A288T, I293V, E297T  
>TK2014| codons 1-324
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKPLTEICTELEKEGKISRIGPENPYNTPI
FAIKKKDGIKWRKVMDFRELNKRTQDFWEVQLGIPHPAGLKKNKSVTVLDVGDAYFSVPL
YEDFRKYTAFTIPSMNNETPGIRYQYNVLPQGWKGSPAIFQDNMTKILEPFRKQNPELII
CQYVDDLYVGSDLEIGQHRTKIEELREHLWKWGFYTPDNKHQKEPPFLWMGYELHPDKWT
VQSIKLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVKQLCKCLRGAKTLTEVVPLTTEAE
LELAENREILKEPVHGVYYDPSKD

References
Author Title Citation
Non-B Workgroup Impact of HIV-1 subtype and antiretroviral therapy on protease and reverse transcriptase genotype: Results of a global collaboration. PLoS Med, 2005