<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA1833 CA4928 U.S. 1998 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 AZT 44
2 D4T 87
3 3TC+AZT+IDV 42
4 3TC+D4T+IDV 26
5 DDC+NFV+NVP 47

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, T69D, L74I, L210W, T215Y   Y181C A98G K20R, T39AE, E44D, V118I, K122E, I135T, S162C, G196E, R211K, L228R, A272S, V276T, K277R, Q278E, L283I, I293V, E297K  
>CA4928| codons 1-303
PISPIETVPVKLKPGMDGPRVKQWPLTEEKIKALVEICAELEKDGKISKIGPENPYNTPV
FAIKKKNSDKWRKIVDFRELNKRTQDFWEVQLGIPHPGGLKKKKSVTVLDVGDAYFSIPL
DEDFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSPAIFQCSMTKILEPFRKQNPDIVI
CQYMDDLYVGSDLEIEQHRTKIEELRQHLWKWGFYTPDKKHQKEPPFRWMGYELHPDKWT
VQPIVLPEKDSWTVNDIQKLVGKLNWASQIYSGIKTRELCKLIRGTKALTEVVPLTKEAE
LEL

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
D30N, M46L, V82A   L10I, T12S, I13IV, G16GE, L19V, L63T, A71V, I72T, I93IL  
>CA4929| codons 1-99
PQITLWQRPIVSVKIEGQVKEALLDTGADNTVLEEMNLPGRWKPKLIGGIGGFIKVRQYD
QITIEICGHKVTGTVLVGPTPANIIGRNLLTQLGCTLNF

References
Author Title Citation
Gonzales, MJ HIV-1 reverse transcriptase and protease subtypes: Classification, amino acid mutation patterns, and prevalence in a northern California clinic-based population. J Infect Dis, 2001
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005