<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
TK2013 TK2013b Denmark 2003 HIV1 G Plasma None

Treatment History
Order Regimen Weeks
1 3TC+ AZT+ IDV 111
2 D4T+ RTV+ SQV 9
3 3TC+ D4T+ NFV 76
4 ABC+ DDI+ EFV 29
5 DDI+ EFV+ 3TC+ D4T 85
6 DDI+ 3TC+ D4T+ LPV 5
7 DDI+ 3TC+ D4T+ RTV+ APV 24

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, L74V, M184V, L210W, T215Y   Y188L V179E V21I, V35T, E36ED, T39A, S48T, V60I, V106I, V118I, E169D, K173R, Q174K, D177E, T200E, E203K, Q207E, R211K, V245Q, D250E, A272PS, E291D, V292I, I293V, E297K, D324E, I329V T240TM
>TK2013b| codons 1-333
PISPIETVPVKLKPGMDGPKIKQWPLTEEKIKALTDICAELEKEGKITKIGPENPYNTPI
FAIKKKDSTKWRKVVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSITVLDVGDAYFSIPL
DKDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILDPFRRKNPEIEI
YQYVDDLLVGSDLEIGQHREKIKELREHLWKWGFYTPDKKHQKEPPFLWMGYELHPDKWM
VQPIQLPEKESWTVNDIQKLVGKLNWASQIYPGIKVKQLCKLLRGTKALTDIVPLTKEAE
LELAENREILKEPVHGVYYDPSKELIAEVQKQG

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46I, I47V, I54V, L90M   L10I, I13V, I15V, K20I, E35D, M36I, N37D, R41K, R57K, Q61H, I66F, H69K, V82I, L89IM, Q92K  
>TK2013b| codons 1-99
PQITLWQRPIVTVKVGGQLIEALLDTGADDTVLEDIDLPGKWKPKIVGGIGGFVKVKQYD
HILIEFCGKKAIGTVLVGPTPINIIGRNIMTKIGCTLNF

References
Author Title Citation
Non-B Workgroup Impact of HIV-1 subtype and antiretroviral therapy on protease and reverse transcriptase genotype: Results of a global collaboration. PLoS Med, 2005