<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
TK2012 TK2012 Denmark 2001 HIV1 A Plasma None

Treatment History
Order Regimen Weeks
1 3TC+ AZT+ RTV 3
2 3TC+ AZT 21
3 3TC+ AZT+ IDV 94
4 3TC+ D4T+ RTV+ SQV 89
5 None 26

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
I54V, L90M   L10V, I13V, K14R, I15V, K20R, E35D, M36I, R41K, R57K, I62V, H69K, T74S, L89I  
>TK2012| codons 1-99
PQITLWQRPVVTVRVGGQLREALLDTGADDTVLEDINLPGKWKPKMIGGIGGFVKVKQYD
QVLIEICGKKAIGSVLVGPTPVNIIGRNIMTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
D67N, M184V, T215F K219E     V35I, V60I, K122E, D123S, I135T, I142V, K173A, D177E, V179I, T200A, Q207A, R211RS, V245E, A272P, K281R, E291D, I293V, P294T  
>TK2012| codons 1-324
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALIEICTEMEKEGKISKIGPENPYNTPI
FAIKKKNSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DESFRKYTAFTIPSTNNETPGVRYQYNVLPQGWKGSPAIFQSSMTKILEPFRAQNPEIII
YQYVDDLYVGSDLEIGQHRAKIEELRAHLLSWGFFTPDEKHQKEPPFLWMGYELHPDKWT
VQPIELPEKDSWTVNDIQKLVGKLNWASQIYPGIKVKQLCRLLRGTKALTDVVTLTEEAE
LELAENREILKEPVHGVYYDPSKD

References
Author Title Citation
Non-B Workgroup Impact of HIV-1 subtype and antiretroviral therapy on protease and reverse transcriptase genotype: Results of a global collaboration. PLoS Med, 2005