<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
TK2010 TK2010c Denmark 2003 HIV1 C Plasma None

Treatment History
Order Regimen Weeks
1 3TC+ AZT+ IDV+ RTV 5
2 3TC+ DDI+ NVP 79
3 D4T+ RTV+ SQV+ TDF 7
4 None 2
5 D4T+ RTV+ SQV+ TDF 8
6 D4T+ TDF+ LPV 36

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    T12TS, I15V, L19IV, M36I, R41K, Q61QE, H69K, L89M, I93L A71AP
>TK2010c| codons 1-99
PQITLWQRPLVSIKVGGQIKEALLDTGADDTVLEEINLPGKWKPKMIGGIGGFIKVRQYD
EILIEICGKKPIGTVLVGPTPVNIIGRNMLTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
        K20KR, K22KN, A33AP, V35M, E36A, T39E, S48ST, K122E, D123G, K173Q, Q174X, D177DE, I195IL, G196GE, T200A, Q207E, R211K, V245Q, E248X, D250DE, K277R, E291D, V292I, I293V, K311KR, V317VA, D324DE  
>TK2010c| codons 1-333
PISPIETVPVKLKPGMDGPRVNQWPLTEEKIKPLMAICEEMEKEGKITKIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DEGFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRQXNPEIVI
YQYMDDLYVGSDLELEQHRAKIEELREHLLKWGFTTPDKKHQKEPPFLWMGYELHPDKWT
VQPIQLPXKESWTVNDIQKLVGKLNWASQIYAGIKVRQLCKLLRGTKALTDIVPLTEEAE
LELAENREILREPVHGAYYDPSKELIAEIQKQG

References
Author Title Citation
Non-B Workgroup Impact of HIV-1 subtype and antiretroviral therapy on protease and reverse transcriptase genotype: Results of a global collaboration. PLoS Med, 2005