<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
TK2010 TK2010 Denmark 2002 HIV1 C Plasma None

Treatment History
Order Regimen Weeks
1 3TC+ AZT+ IDV+ RTV 5
2 3TC+ DDI+ NVP 77

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
L74V, M184V   Y188L   V35M, E36A, T39E, K122E, D123G, K173T, Q174N, D177E, T200A, Q207E, R211K, V245Q, E248X, D250DE, K277R, Q278QK, E291D, V292I, I293V, K311R  
>TK2010| codons 1-318
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALMAICEEMEKEGKISKIGPENPYNTPV
FAIKKKDSTKWRKVVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DEGFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRTNNPEIVI
YQYVDDLLVGSDLEIGQHRAKIEELREHLLKWGFTTPDKKHQKEPPFLWMGYELHPDKWT
VQPIQLPXKESWTVNDIQKLVGKLNWASQIYAGIKVRKLCKLLRGTKALTDIVPLTEEAE
LELAENREILREPVHGVY

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    T12S, I15V, L19I, M36I, R41K, Q61E, H69K, L89M, I93L  
>TK2010| codons 1-99
PQITLWQRPLVSIKVGGQIKEALLDTGADDTVLEEINLPGKWKPKMIGGIGGFIKVRQYD
EILIEICGKKAIGTVLVGPTPVNIIGRNMLTQLGCTLNF

References
Author Title Citation
Non-B Workgroup Impact of HIV-1 subtype and antiretroviral therapy on protease and reverse transcriptase genotype: Results of a global collaboration. PLoS Med, 2005