<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
TK2006 TK2006a Denmark 2003 HIV1 C Plasma None

Treatment History
Order Regimen Weeks
1 AZT 7
2 AZT+ DDI 6
3 DDI 26
4 AZT 4
5 AZT+ 3TC 38
6 AZT+ 3TC+ IDV 33
7 AZT+ 3TC+ RTV+ SQV 1
8 None 8
9 3TC+ AZT 23
10 3TC+ D4T+ EFV 23
11 None 21
12 3TC+ D4T+ EFV 112
13 None 6
14 3TC+ D4T+ DDI+ EFV 30
15 None 2
16 3TC+ D4T+ DDI+ EFV 10
17 None 2
18 3TC+ D4T+ DDI+ EFV 14

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    I15V, L19I, M36I, R41K, L63P, H69K, I93L  
>TK2006a| codons 1-99
PQITLWQRPLVTIKVGGQIKEALLDTGADDTVLEEINLPGKWKPKMIGGIGGFIKVRQYD
QIPIEICGKKAIGTVLVGPTPVNIIGRNLLTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M184V   K103KN, Y188L V179FL V35T, T39D, S48T, V90I, K101R, K122E, D123G, S162Y, K166KR, K173A, Q174K, D177E, T200A, Q207E, R211K, F214L, V245Q, D250E, A272P, K277R, I293V, E297K, V317VA  
>TK2006a| codons 1-333
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALTEICDEMEKEGKITKIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKRTQDFWEIQLGIPHPAGLRKNKSVTVLDVGDAYFSVPL
DEGFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQYSMTRILEPFRAKNPEIFI
YQYVDDLLVGSDLEIGQHRAKIEELREHLLKWGLTTPDKKHQKEPPFLWMGYELHPDKWT
VQPIQLPEKESWTVNDIQKLVGKLNWASQIYPGIKVRQLCKLLRGTKALTEVVPLTKEAE
LELAENREILKEPVHGAYYDPSKDLIAEIQKQG

References
Author Title Citation
Non-B Workgroup Impact of HIV-1 subtype and antiretroviral therapy on protease and reverse transcriptase genotype: Results of a global collaboration. PLoS Med, 2005