<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
TK2005 TK2005b Denmark 2003 HIV1 D Plasma None

Treatment History
Order Regimen Weeks
1 3TC+ D4T+ RTV 13
2 3TC+ D4T+ IDV 122
3 3TC+ ABC+ DDI+ EFV 123
4 None 19
5 ABC+ APV 52
6 AZT+ RTV+ SQV+ TDF 26

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
I54V, V82AT L10LF I13V, I15IV, K20KT, R41K, L63P, I64V, A71AV, T74S  
>TK2005b| codons 1-99
PQITLWQRPFVTVKVGGQLTEALLDTGADDTVLEEMNLPGKWKPKMIGGIGGFVKVRQYD
QIPVEICGHKVIGSVLVGPTPANIIGRNLLTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
D67DN, T69D, K70R, L74V, T215CY K219Q L100I, K103N   V35T, K49R, V60I, K102E, K122KE, I135T, T139TK, I159IV, S162Y, D177E, V189VI, I202V, Q207E, R211K, L228H, V245K, D250E, A272P, K277R, L282C, L283I, T286A, A288AT, I293V, E297K T253TN
>TK2005b| codons 1-334
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALTEICTEMEKEGKISRIGPENPYNTPI
FAIKKKNSDRWRKVVDFRELNKRTQDFWEVQLGIPHPAGIKENKSVTVLDVGDAYFSVPL
DEDFRKYTAFTIPSTNNEKPGIRYQYNVLPQGWKGSPAVFQYSMTKILEPFRKQNPEIVI
YQYMDDLYIGSDLEIGQHRTKVEELREHLLKWGFCTPDQKHQKEPPFHWMGYELHPDKWT
VQPIKLPEKESWNVNDIQKLVGKLNWASQIYPGIKVRQLCKCIRGAKTLTEVVPLTKEAE
LELAENREILKEPVHGVYYDPSKDLIAEIQKQGQ

References
Author Title Citation
Non-B Workgroup Impact of HIV-1 subtype and antiretroviral therapy on protease and reverse transcriptase genotype: Results of a global collaboration. PLoS Med, 2005