<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
TK2005 TK2005 Denmark 2001 HIV1 D Plasma None

Treatment History
Order Regimen Weeks
1 3TC+ D4T+ RTV 13
2 3TC+ D4T+ IDV 122
3 3TC+ ABC+ DDI+ EFV 119

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
I54IV   K20KT, R41K, L63P, I64V, T74TS, V82I  
>TK2005| codons 1-99
PQITLWQRPLVTIKIGGQLTEALLDTGADDTVLEEMNLPGKWKPKMIGGIGGFVKVRQYD
QIPVEICGHKAIGSVLVGPTPINIIGRNLLTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
D67N, T69D, K70KR, L74V, M184V K219Q L100I, K103N   V35T, K49R, V60I, K102E, D121DY, K122KE, I135T, T139K, S162Y, D177E, V189I, I202V, Q207E, R211K, T215X, L228H, V245K, D250E, A272P, K277R, L282C, L283I, T286A, A288T, I293V, E297K T253N
>TK2005| codons 1-324
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALTEICTEMEKEGKISRIGPENPYNTPI
FAIKKKNSDRWRKVVDFRELNKRTQDFWEVQLGIPHPAGIKENKSVTVLDVGDAYFSVPL
YEDFRKYTAFTIPSTNNEKPGIRYQYNVLPQGWKGSPAIFQYSMTKILEPFRKQNPEIVI
YQYVDDLYIGSDLEIGQHRTKVEELREHLLKWGFXTPDQKHQKEPPFHWMGYELHPDKWT
VQPIKLPEKESWNVNDIQKLVGKLNWASQIYPGIKVRQLCKCIRGAKTLTEVVPLTKEAE
LELAENREILKEPVHGVYYDPSKD

References
Author Title Citation
Non-B Workgroup Impact of HIV-1 subtype and antiretroviral therapy on protease and reverse transcriptase genotype: Results of a global collaboration. PLoS Med, 2005