<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
TK2002 TK2002 Denmark 2003 HIV1 A Plasma None

Treatment History
Order Regimen Weeks
1 3TC+AZT+IDV 215
2 3TC+D4T+IDV+RTV 58
3 ABC+AZT+EFV 24

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46MI, V82AT L33I, N83D L10LI, I13V, K14R, A22AV, E35D, M36I, R41K, R57K, H69K, L89IM  
>TK2002| codons 1-99
PQITLWQRPIVTVRIGGQLKEVLLDTGADDTVIEDINLPGKWKPKIIGGIGGFIKVKQYD
QILIEICGKKAIGTVLVGPTPADIIGRNILTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
        K20R, V21I, V35T, T39G, V60I, K122E, D123NS, I135T, K173S, Q174QK, D177E, V179I, T200A, I202V, Q207A, R211S, V245QR, S251C, T286A, E291D, I293V, P294T, G335D E248C
>TK2002| codons 1-345
PISPIETVPVKLKPGMDGPRIKQWPLTEEKIKALTEICGEMEKEGKISKIGPENPYNTPI
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DENFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRSKNPEIII
YQYMDDLYVGSDLEIGQHRAKVEELRAHLLSWGFTTPDKKHQKEPPFLWMGYELHPDKWT
VQPIQLPCKDCWTVNDIQKLVGKLNWASQIYAGIKVKQLCKLLRGAKALTDVVTLTEEAE
LELAENREILKEPVHGVYYDPSKDLIAEIQKQGQDQWTYQIYQEP

References
Author Title Citation
Non-B Workgroup Impact of HIV-1 subtype and antiretroviral therapy on protease and reverse transcriptase genotype: Results of a global collaboration. PLoS Med, 2005