<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
TK2001 TK2001a Denmark 2002 HIV1 D Plasma None

Treatment History
Order Regimen Weeks
1 3TC+ D4T+ RTV+ SQV 3
2 3TC+ D4T+ NFV 49
3 AZT+ DDI 7
4 AZT+ DDI+ SQV 1
5 AZT+ DDI 8
6 AZT+ DDI+ ABC 28
7 DDI+ EFV+ NFV 13
8 NFV+ ABC+ AZT+ NVP 2
9 NFV+ AZT+ NVP+ 3TC 1
10 NFV+ NVP+ 3TC 25
11 3TC+ D4T+ EFV 116
12 TDF+ ABC+ LPV 3
13 None 4
14 TDF+ D4T 10

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, K70R, L74I, T215F D67G, K219Q L100I, Y188L   K20R, V35T, E53EQ, V60I, S68SG, T69IN, D123E, I135V, S163X, K166R, D177E, V179VI, T200I, Q207E, R211K, D218E, L228H, Q242QH, V245K, D250E, A272P, K275R, K277R, Q278H, L282C, L283I, A288AT, I293V Q161QH
>TK2001a| codons 1-314
PISPIETVPVKLKPGMDGPRVKQWPLTEEKIKALTEICTELEKEGKISKIGPQNPYNTPI
FAIKKKGGIRWRKIVDFRELNKRTQDFWEVQLGIPHPAGIKKKKSVTVLDVGDAYFSVPL
DKEFRKYTAFTIPSVNNETPGIRYQYNVLPQGWKGSPAIFHSXMTRILEPFRKQNPEIII
YQYMDDLLVGSDLEIGQHRIKIEELREHLLKWGFFTPEQKHQKEPPFHWMGYELHPDKWT
VHPIKLPEKESWTVNDIQKLVGKLNWASQIYPGIRVRHLCKCIRGTKTLTEVVPLTEEAE
LELAENREILKEPV

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46MI, I84IV N83ND L10I, I13V, K14KR, A22AV, E35EG, M36I, I62V, L63P, I64V, A71AV, I93IL  
>TK2001a| codons 1-99
PQITLWQRPIVTVRIGGQLKEVLLDTGADDTVLEGINLPGRWKPKIIGGIGGFIKVRQYD
QVPVEICGHKVIGTVLVGPTPVDVIGRNLLTQLGCTLNF

References
Author Title Citation
Non-B Workgroup Impact of HIV-1 subtype and antiretroviral therapy on protease and reverse transcriptase genotype: Results of a global collaboration. PLoS Med, 2005