<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
TK2001 TK2001 Denmark 2001 HIV1 D Plasma None

Treatment History
Order Regimen Weeks
1 3TC+ D4T+ RTV+ SQV 3
2 3TC+ D4T+ NFV 49
3 AZT+ DDI 7
4 AZT+ DDI+ SQV 1
5 AZT+ DDI 8
6 AZT+ DDI+ ABC 28
7 DDI+ EFV+ NFV 13
8 NFV+ ABC+ AZT+ NVP 2
9 NFV+ AZT+ NVP+ 3TC 1
10 NFV+ NVP+ 3TC 25
11 3TC+ D4T+ EFV 58

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46I, I84V N83D L10I, I13V, A22V, E35G, M36I, I62V, L63P, I64V, A71V, I93L  
>TK2001| codons 1-99
PQITLWQRPIVTVKIGGQLKEVLLDTGADDTVLEGINLPGRWKPKIIGGIGGFIKVRQYD
QVPVEICGHKVIGTVLVGPTPVDVIGRNLLTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, K70R, L74I, M184V, T215F D67G, K219Q L100I, Y188L   K20R, V35T, K49KR, E53Q, V60I, T69N, D123E, I135V, K166R, D177E, T200I, Q207E, R211K, D218E, V245K, D250E, A272P, K275R, K277R, Q278H, L282C, L283I, I293V, G316X  
>TK2001| codons 1-323
PISPIETVPVKLKPGMDGPRVKQWPLTEEKIKALTEICTELEKEGKISRIGPQNPYNTPI
FAIKKKGSNRWRKIVDFRELNKRTQDFWEVQLGIPHPAGIKKKKSVTVLDVGDAYFSVPL
DKEFRKYTAFTIPSVNNETPGIRYQYNVLPQGWKGSPAIFQSSMTRILEPFRKQNPEIVI
YQYVDDLLVGSDLEIGQHRIKIEELREHLLKWGFFTPEQKHQKEPPFLWMGYELHPDKWT
VQPIKLPEKESWTVNDIQKLVGKLNWASQIYPGIRVRHLCKCIRGTKALTEVVPLTEEAE
LELAENREILKEPVHXVYYDPSK

References
Author Title Citation
Non-B Workgroup Impact of HIV-1 subtype and antiretroviral therapy on protease and reverse transcriptase genotype: Results of a global collaboration. PLoS Med, 2005