<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
TK1030 TK1030 Denmark 2000 HIV1 A Plasma None

Treatment History
Order Regimen Weeks
1 3TC+ D4T+ RTV+ SQV 62
2 3TC+ D4T+ RTV+ IDV 33
3 3TC+ RTV+ IDV+ AZT+ DDI+ EFV 51

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    L10I, I13V, G16E, E35D, M36I, R41K, R57K, L63S, H69K, L89M  
>TK1030| codons 1-99
PQITLWQRPIVTVKIEGQLKEALLDTGADDTVLEDINLPGKWKPKMIGGIGGFIKVKQYD
QISIEICGKKAIGTVLVGPTPVNIIGRNMLTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
    K103N   K20R, V35T, V60I, K102Q, K122E, I135T, K173A, Q174K, D177E, V179I, I202V, Q207A, L210LF, R211S, F214L, E248D, D250E, A272P, T286A, E291D, V292I, I293V, E312D  
>TK1030| codons 1-324
PISPIETVPVKLKPGMDGPRVKQWPLTEEKIKALTEICTEMEKEGKISKIGPENPYNTPI
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKQNKSVTVLDVGDAYFSVPL
DEDFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRAKNPEIII
YQYMDDLYVGSDLEIGQHRTKVEELRAHLFSWGLTTPDKKHQKEPPFLWMGYELHPDKWT
VQPIVLPDKESWTVNDIQKLVGKLNWASQIYPGIKVKQLCKLLRGAKALTDIVPLTEEAE
LELAENREILKDPVHGVYYDPSKD

References
Author Title Citation
Non-B Workgroup Impact of HIV-1 subtype and antiretroviral therapy on protease and reverse transcriptase genotype: Results of a global collaboration. PLoS Med, 2005