<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA1829 CA4923 U.S. 1998 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 AZT+DDC 41
2 AZT+D4T+DDC 52
3 3TC+D4T 39
4 3TC+IDV 32
5 3TC+DLV+NFV 61

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46I L10F, V32T M36I, L63P, I64V, A71V  
>CA4923| codons 1-99
PQITLWQRPFVTIKIGGQLKEALLDTGADDTTLEEINLPGRWKPKIIGGIGGFIKVRQYD
QIPVEICGHKVIGTVLVGPTPVNIIGRNLLTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, T69S_VT, M184V, L210W A62V, D67E, T215C, K219N K103KN, Y181C V108VI K20R, K122E, D177E, L228H, V245E, A272P, I293V, E297K, A304G, E305X, Q334N, G335D, R356RK, T386TA, A400T, S468P, L469I, L491S, A508G, Q520L A376AFSV
>CA4924| codons 1-560
PISPIETVPVKLKPGMDGPRVKQWPLTEEKIKALVEICTELEKEGKISKIGPENPYNTPV
FVIKKKESSKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKNKSVTILDVGDAYFSVPL
DEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPEIVI
CQYVDDLYVGSDLEIGQHRTKIEELRQHLWRWGFCTPDNKHQKEPPFHWMGYELHPDKWT
VQPIELPEKDSWTVNDIQKLVGKLNWASQIYPGIKVKQLCKLLRGTKALTEVVPLTKEAE
LELGXNREILKEPVHGVYYDPSKDLIAEIQKQGNDQWTYQIYQEPFKNLKTGKYAKMRGA
HTNDVKQLTEAVQKIVTESIVIWGKAPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTP
PLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTDRGRQKVVPITDTTNQKTELQ
AIHLALQDSGSEVNIVTDSQYALGIIQGQPDKSESELVSLIIEQLIKKEKVYLAWVPAHK
GIGGNEQVDKLVSAGIRKVL

References
Author Title Citation
Wu, TD Mutation patterns and structural correlates in human immunodeficiency virus type 1 protease following different protease inhibitor treatments. J Virol, 2003
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005