<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
TK1028 TK1028b Denmark 2002 HIV1 D Plasma None

Treatment History
Order Regimen Weeks
1 AZT 100
2 AZT+ 3TC 65
3 AZT+ 3TC+ RTV 13
4 AZT+ 3TC+ IDV 91
5 ABC+ D4T+ NFV+ NVP 139
6 D4T+ 3TC+ IDV+ RTV 65

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46L, I54V, V82T L24I L10I, I13V, E35D, M36I, N37S, R41K, K55R, L63P, I64V, A71V, I72V, V77I, I93L  
>TK1028b| codons 1-99
PQITLWQRPIVTVKIGGQLKEALIDTGADDTVLEDISLPGKWKPKLIGGIGGFVRVRQYD
QIPVEICGHKVVGTVLIGPTPTNIIGRNLLTQLGCTLNF

References
Author Title Citation
Non-B Workgroup Impact of HIV-1 subtype and antiretroviral therapy on protease and reverse transcriptase genotype: Results of a global collaboration. PLoS Med, 2005