Isolate Data
| Patient | Isolate | Region | Year | Species | Subtype | Source | Clone Method |
| TK1028 | TK1028b | Denmark | 2002 | HIV1 | D | Plasma | None |
Treatment History
| Order | Regimen | Weeks |
| 1 | AZT | 100 |
| 2 | AZT+ 3TC | 65 |
| 3 | AZT+ 3TC+ RTV | 13 |
| 4 | AZT+ 3TC+ IDV | 91 |
| 5 | ABC+ D4T+ NFV+ NVP | 139 |
| 6 | D4T+ 3TC+ IDV+ RTV | 65 |
Protease Sequence
| PIMajorDRMs | PIMinorDRMs | Polys | UnusualMuts |
| M46L, I54V, V82T | L24I | L10I, I13V, E35D, M36I, N37S, R41K, K55R, L63P, I64V, A71V, I72V, V77I, I93L |
| >TK1028b| codons 1-99 PQITLWQRPIVTVKIGGQLKEALIDTGADDTVLEDISLPGKWKPKLIGGIGGFVRVRQYD QIPVEICGHKVVGTVLIGPTPTNIIGRNLLTQLGCTLNF |
References
| Author | Title | Citation |
| Non-B Workgroup | Impact of HIV-1 subtype and antiretroviral therapy on protease and reverse transcriptase genotype: Results of a global collaboration. | PLoS Med, 2005 |