<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
TK1028 TK1028a Denmark 2001 HIV1 D Plasma None

Treatment History
Order Regimen Weeks
1 AZT 100
2 AZT+ 3TC 65
3 AZT+ 3TC+ RTV 13
4 AZT+ 3TC+ IDV 91
5 ABC+ D4T+ NFV+ NVP 127

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, K70R, T215F K219Q G190A   K20R, K22R, V35T, T39S, V60I, D121Y, K122E, I135T, I178M, V179I, G196E, T200R, Q207E, R211K, D218E, V245K, D250E, A272P, Q278H, L282C, T286A, I293V, E297R K275T
>TK1028a| codons 1-324
PISPIETVPVKLKPGMDGPRVRQWPLTEEKIKALTEICSELEKEGKISKIGPENPYNTPI
FAIKKKNSTRWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
YEDFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDMII
YQYMDDLYVASDLEIEQHRRKIEELREHLLKWGFFTPEQKHQKEPPFLWMGYELHPDKWT
VQPIKLPEKESWTVNDIQKLVGKLNWASQIYPGITVKHLCKCLRGAKALTEVVPLTREAE
LELAENREILKEPVHGVYYDPSKD

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46I, I54V, V82T L24I L10I, I13V, E35D, M36I, N37S, R41K, K55R, L63P, I64V, A71V, I72V, V77I, I93L P1PS
>TK1028a| codons 1-99
SQITLWQRPIVTVKIGGQLKEALIDTGADDTVLEDISLPGKWKPKIIGGIGGFVRVRQYD
QIPVEICGHKVVGTVLIGPTPTNIIGRNLLTQLGCTLNF

References
Author Title Citation
Non-B Workgroup Impact of HIV-1 subtype and antiretroviral therapy on protease and reverse transcriptase genotype: Results of a global collaboration. PLoS Med, 2005