<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
TK1027 TK1027 Denmark 2002 HIV1 C Plasma None

Treatment History
Order Regimen Weeks
1 3TC+ AZT 4
2 3TC+ AZT+ IDV 139
3 IDV+ ABC+ EFV+ RTV 13
4 IDV+ ABC+ RTV+ NVP 17
5 None 8
6 ABC+ IDV+ NVP+ RTV 47
7 None 4
8 3TC+ ABC+ AZT 4
9 None 55

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
  L89V I15V, L19I, M36I, R41K, H69K, I93IL  
>TK1027| codons 1-99
PQITLWQRPLVTIKVGGQIKEALLDTGADDTVLEEINLPGKWKPKMIGGIGGFIKVRQYD
QILIEICGKKAIGTVLVGPTPVNIIGRNVLTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
        V35T, E36A, T39AE, S48T, K122E, D123G, K173T, T200A, Q207E, R211K, V245Q, A272P, K277R, E291D, V292I, I293V  
>TK1027| codons 1-324
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALTAICAEMEKEGKITKIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DEGFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRTQNPDIVI
YQYMDDLYVGSDLEIGQHRAKIEELREHLLKWGFTTPDKKHQKEPPFLWMGYELHPDKWT
VQPIQLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLCKLLRGTKALTDIVPLTEEAE
LELAENREILKEPVHGVYYDPSKD

References
Author Title Citation
Non-B Workgroup Impact of HIV-1 subtype and antiretroviral therapy on protease and reverse transcriptase genotype: Results of a global collaboration. PLoS Med, 2005