<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
TK1024 TK1024a Denmark 2003 HIV1 D Plasma None

Treatment History
Order Regimen Weeks
1 3TC+ AZT+ IDV 70
2 3TC+ AZT+ NFV 6
3 3TC+ AZT+ NFV+ IDV 36
4 IDV+ ABC+ D4T+ EFV+ RTV 6
5 IDV+ ABC+ D4T+ EFV 23
6 IDV+ ABC+ D4T+ EFV+ RTV 4
7 None 3
8 ABC+ D4T+ IDV+ NVP+ RTV 6
9 None 8
10 ABC+ D4T+ IDV+ NVP+ RTV 4
11 ABC+ D4T+ IDV+ RTV 2
12 None 5
13 ABC+ D4T+ IDV+ RTV 76
14 ABC+ D4T+ LPV+ NVP 19
15 ABC+ LPV+ NVP 14
16 ABC+ NVP+ D4T+ NFV 11
17 None 56

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    I13V, K20M, M36I, R41K, I62IV, L63P, I64V, H69HY, I72E, P79X  
>TK1024a| codons 1-99
PQITLWQRPLVTVKIGGQLMEALLDTGADDTVLEEINLPGKWKPKMIGGIGGFIKVRQYD
QVPVEICGYKAEGTVLVGXTPVNIIGRNLLTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
        V35T, E36D, K49KR, V60I, E169ED, Q207E, R211K, V245K, D250E, A272P, K275R, K277R, L282C, L283I, I293V, K311R  
>TK1024a| codons 1-334
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALTDICTEMEKEGKISRIGPENPYNTPI
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DKDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILDPFRKQNPDIVI
YQYMDDLYVGSDLEIGQHRTKIEELREHLLKWGFTTPDKKHQKEPPFLWMGYELHPDKWT
VQPIKLPEKESWTVNDIQKLVGKLNWASQIYPGIRVRQLCKCIRGTKALTEVVPLTEEAE
LELAENREILREPVHGVYYDPSKDLIAEIQKQGQ

References
Author Title Citation
Non-B Workgroup Impact of HIV-1 subtype and antiretroviral therapy on protease and reverse transcriptase genotype: Results of a global collaboration. PLoS Med, 2005