<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
TK1024 TK1024 Denmark 2002 HIV1 D Plasma None

Treatment History
Order Regimen Weeks
1 3TC+ AZT+ IDV 70
2 3TC+ AZT+ NFV 6
3 3TC+ AZT+ NFV+ IDV 36
4 IDV+ ABC+ D4T+ EFV+ RTV 6
5 IDV+ ABC+ D4T+ EFV 23
6 IDV+ ABC+ D4T+ EFV+ RTV 4
7 None 3
8 ABC+ D4T+ IDV+ NVP+ RTV 6
9 None 8
10 ABC+ D4T+ IDV+ NVP+ RTV 4
11 ABC+ D4T+ IDV+ RTV 2
12 None 5
13 ABC+ D4T+ IDV+ RTV 76
14 ABC+ D4T+ LPV+ NVP 1

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    I13V, K20M, M36I, R41K, K45KR, L63P, I64V, H69HY, I72E, P79PA  
>TK1024| codons 1-99
PQITLWQRPLVTVKIGGQLMEALLDTGADDTVLEEINLPGKWKPRMIGGIGGFIKVRQYD
QIPVEICGYKAEGTVLVGATPVNIIGRNLLTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
        V35I, K49KR, V60I, T200TI, Q207E, R211K, V245K, D250E, A272P, K275R, K277R, L282C, L283I, I293V, K311R, K323KE Q91QH
>TK1024| codons 1-324
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALIEICTEMEKEGKISRIGPENPYNTPI
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVHLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DKDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVI
YQYMDDLYVGSDLEIGQHRIKIEELREHLLKWGFTTPDKKHQKEPPFLWMGYELHPDKWT
VQPIKLPEKESWTVNDIQKLVGKLNWASQIYPGIRVRQLCKCIRGTKALTEVVPLTEEAE
LELAENREILREPVHGVYYDPSED

References
Author Title Citation
Non-B Workgroup Impact of HIV-1 subtype and antiretroviral therapy on protease and reverse transcriptase genotype: Results of a global collaboration. PLoS Med, 2005