<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
TK1021 TK1021a Denmark 2002 HIV1 C Plasma None

Treatment History
Order Regimen Weeks
1 3TC+ AZT+ IDV 52
2 3TC+ IDV+ D4T 208
3 3TC+ IDV+ D4T+ RTV 12
4 ABC+ DDI+ LPV 60
5 None 16

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
        V35T, E36A, T39E, S48T, V60I, S68SG, V90I, K122E, D123S, I135V, E138A, K166R, K173T, T200A, Q207D, R211K, V245Q, E248D, A272P, K275KR, K277R, T286A, E291D, V292I, I293V  
>TK1021a| codons 1-324
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALTAICEEMEKEGKITKIGPENPYNTPI
FAIKKKDGTKWRKLVDFRELNKRTQDFWEIQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DESFRKYTAFTIPSVNNATPGIRYQYNVLPQGWKGSPAIFQSSMTRILEPFRTQNPDIVI
YQYMDDLYVGSDLEIGQHRAKIEELRDHLLKWGFTTPDKKHQKEPPFLWMGYELHPDKWT
VQPIQLPDKDSWTVNDIQKLVGKLNWASQIYPGIRVRQLCKLLRGAKALTDIVPLTEEAE
LELAENREILKEPVHGVYYDPSKD

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46MI, I54IV, V82VA L10LF, L24LI, Q58QE T12S, I15IV, L19IV, E35D, M36I, N37D, R41K, K55KR, D60E, Q61E, I62IV, L63P, H69K, L89M, I93L  
>TK1021a| codons 1-99
PQITLWQRPFVSIKVGGQIKEALIDTGADDTVLEDIDLPGKWKPKIIGGIGGFVRVREYE
EVPIEICGKKAIGTVLVGPTPANIIGRNMLTQLGCTLNF

References
Author Title Citation
Non-B Workgroup Impact of HIV-1 subtype and antiretroviral therapy on protease and reverse transcriptase genotype: Results of a global collaboration. PLoS Med, 2005