<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
TK1021 TK1021 Denmark 2002 HIV1 C Plasma None

Treatment History
Order Regimen Weeks
1 3TC+ AZT+ IDV 52
2 3TC+ IDV+ D4T 208
3 3TC+ IDV+ D4T+ RTV 12
4 ABC+ DDI+ LPV 59

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
K65R, M184V       V35T, E36A, T39E, S48T, V60I, S68G, V90I, K122E, D123S, I135V, E138A, K166R, K173T, E194X, T200A, Q207D, R211K, V245Q, E248D, A272P, K275KR, K277R, T286A, E291D, V292I, I293V  
>TK1021| codons 1-311
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALTAICEEMEKEGKITKIGPENPYNTPI
FAIKRKDGTKWRKLVDFRELNKRTQDFWEIQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DESFRKYTAFTIPSVNNATPGIRYQYNVLPQGWKGSPAIFQSSMTRILEPFRTQNPDIVI
YQYVDDLYVGSDLXIGQHRAKIEELRDHLLKWGFTTPDKKHQKEPPFLWMGYELHPDKWT
VQPIQLPDKDSWTVNDIQKLVGKLNWASQIYPGIRVRQLCKLLRGAKALTDIVPLTEEAE
LELAENREILK

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46I, I54V, V82A L10F, L24I, Q58E T12S, L19I, E35D, M36I, N37D, R41K, K55R, D60E, Q61E, I62V, L63P, H69K, L89M, I93L  
>TK1021| codons 1-99
PQITLWQRPFVSIKIGGQIKEALIDTGADDTVLEDIDLPGKWKPKIIGGIGGFVRVREYE
EVPIEICGKKAIGTVLVGPTPANIIGRNMLTQLGCTLNF

References
Author Title Citation
Non-B Workgroup Impact of HIV-1 subtype and antiretroviral therapy on protease and reverse transcriptase genotype: Results of a global collaboration. PLoS Med, 2005