<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
TK1020 TK1020b Denmark 2004 HIV1 C Plasma None

Treatment History
Order Regimen Weeks
1 AZT 39
2 AZT+ DDI 17
3 AZT+ 3TC 4
4 AZT+ 3TC+ SQV 21
5 AZT+ 3TC+ SQV+ RTV 147
6 RTV+ ABC+ EFV+ IDV 52
7 ABC+ 3TC+ DDI+ LPV 172

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, L74V, M184V, T215Y   K103N   V35R, T39D, E44D, S48ST, K101Q, V118VI, K122E, D123G, K173T, Q174K, D177E, T200A, Q207E, L210S, R211K, D218E, V245Q, A272P, K277R, V292I, I293V, E297A  
>TK1020b| codons 1-333
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALREICDELEKDGKITKIGPENPYNTPV
FAIKKKNSTKWRKVVDFRELNKRTQDFWEVQLGIPHPAGLQKNKSVTVLDVGDAYFSIPL
DEGFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRTKNPEIVI
YQYVDDLYVGSDLEIGQHRAKIEELREHLSKWGFYTPEKKHQKEPPFLWMGYELHPDKWT
VQPIQLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLCKLLRGTKALTEIVPLTAEAE
LELAENREILKEPVHGVYYDPSKDLIAEIQKQG

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46I, I47V, I54V, V82C, L90M L23I, K43T, F53L L10I, I15V, L19I, K20R, E35D, M36I, N37D, R41RK, K55H, I62V, L63P, H69K, T74E, L89M, I93L  
>TK1020b| codons 1-99
PQITLWQRPIVTIKVGGQIREAILDTGADDTVLEDIDLPGKWTPKIVGGIGGLVHVRQYD
QVPIEICGKKAIGEVLVGPTPCNIIGRNMMTQLGCTLNF

References
Author Title Citation
Non-B Workgroup Impact of HIV-1 subtype and antiretroviral therapy on protease and reverse transcriptase genotype: Results of a global collaboration. PLoS Med, 2005