<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
TK1020 TK1020a Denmark 2001 HIV1 C Plasma None

Treatment History
Order Regimen Weeks
1 AZT 39
2 AZT+ DDI 17
3 AZT+ 3TC 4
4 AZT+ 3TC+ SQV 21
5 AZT+ 3TC+ SQV+ RTV 147
6 RTV+ ABC+ EFV+ IDV 52
7 ABC+ 3TC+ DDI+ LPV 9

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46L, I54V, V82C, L90M L23I, F53L L10I, I15V, L19I, K20R, E35D, M36I, N37D, K55H, L63P, H69K, T74A, L89M, I93L  
>TK1020a| codons 1-99
PQITLWQRPIVTIKVGGQIREAILDTGADDTVLEDIDLPGRWKPKLIGGIGGLVHVRQYD
QIPIEICGKKAIGAVLVGPTPCNIIGRNMMTQLGCTLNF

References
Author Title Citation
Non-B Workgroup Impact of HIV-1 subtype and antiretroviral therapy on protease and reverse transcriptase genotype: Results of a global collaboration. PLoS Med, 2005