Isolate Data
| Patient | Isolate | Region | Year | Species | Subtype | Source | Clone Method |
| TK1020 | TK1020a | Denmark | 2001 | HIV1 | C | Plasma | None |
Treatment History
| Order | Regimen | Weeks |
| 1 | AZT | 39 |
| 2 | AZT+ DDI | 17 |
| 3 | AZT+ 3TC | 4 |
| 4 | AZT+ 3TC+ SQV | 21 |
| 5 | AZT+ 3TC+ SQV+ RTV | 147 |
| 6 | RTV+ ABC+ EFV+ IDV | 52 |
| 7 | ABC+ 3TC+ DDI+ LPV | 9 |
Protease Sequence
| PIMajorDRMs | PIMinorDRMs | Polys | UnusualMuts |
| M46L, I54V, V82C, L90M | L23I, F53L | L10I, I15V, L19I, K20R, E35D, M36I, N37D, K55H, L63P, H69K, T74A, L89M, I93L |
| >TK1020a| codons 1-99 PQITLWQRPIVTIKVGGQIREAILDTGADDTVLEDIDLPGRWKPKLIGGIGGLVHVRQYD QIPIEICGKKAIGAVLVGPTPCNIIGRNMMTQLGCTLNF |
References
| Author | Title | Citation |
| Non-B Workgroup | Impact of HIV-1 subtype and antiretroviral therapy on protease and reverse transcriptase genotype: Results of a global collaboration. | PLoS Med, 2005 |