<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
TK1020 TK1020 Denmark 2000 HIV1 C Plasma None

Treatment History
Order Regimen Weeks
1 AZT 39
2 AZT+ DDI 17
3 AZT+ 3TC 4
4 AZT+ 3TC+ SQV 21
5 AZT+ 3TC+ SQV+ RTV 147
6 RTV+ ABC+ EFV+ IDV 43

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
I54V, V82C, L90M F53L L10I, I15V, L19I, K20R, E35D, M36I, N37D, R41K, K55H, L63P, H69K, T74A, L89M, I93L  
>TK1020| codons 1-99
PQITLWQRPIVTIKVGGQIREALLDTGADDTVLEDIDLPGKWKPKMIGGIGGLVHVRQYD
QIPIEICGKKAIGAVLVGPTPCNIIGRNMMTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, M184V, T215Y   K103N   V35R, T39D, E44D, S48T, K122E, D123G, K173T, Q174K, D177E, T200A, Q207E, L210S, R211K, D218E, E224EK, V245Q, A272P, K277R, E291D, V292I, I293V, E297A P236PS
>TK1020| codons 1-324
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALREICDELEKDGKITKIGPENPYNTPV
FAIKKKNSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKNKSVTVLDVGDAYFSVPL
DEGFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRTKNPEIVI
YQYVDDLYVGSDLEIGQHRAKIEELREHLSKWGFYTPEKKHQKKPPFLWMGYELHSDKWT
VQPIQLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLCKLLRGTKALTDIVPLTAEAE
LELAENREILKEPVHGVYYDPSKD

References
Author Title Citation
Non-B Workgroup Impact of HIV-1 subtype and antiretroviral therapy on protease and reverse transcriptase genotype: Results of a global collaboration. PLoS Med, 2005