<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
TK1018 TK1018 Denmark 2000 HIV1 CRF01_AE Plasma None

Treatment History
Order Regimen Weeks
1 AZT+ DDI 30
2 AZT+ DDI+ RTV 34
3 RTV+ 3TC+ D4T+ SQV 113
4 RTV+ D4T+ ABC+ EFV+ IDV 37

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
I84V L33F, N83D L10V, I13V, E34Q, M36I, N37S, R41K, L63P, H69K, L89M, I93L  
>TK1018| codons 1-99
PQITLWQRPVVTVKIGGQLKEALLDTGADDTVFQEISLPGKWKPKMIGGIGGFIKVRQYD
QIPIEICGKKAIGTVLVGPTPVDVIGRNMLTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
D67N, T69D, K70R, M184V K219EQ K103N   E6D, V8I, K11T, V35T, T39K, E53D, K102KR, K122E, D123N, K173IM, Q174K, D177E, I178M, T200TA, Q207A, R211S, K238R, V245E, T286TA, E291D, I293V  
>TK1018| codons 1-294
PISPIDTIPVTLKPGMDGPKVKQWPLTEEKIKALTEICKEMEKEGKISKIGPDNPYNTPV
FAIKKKNSDRWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKRNKSVTVLDVGDAYFSVPL
DENFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRIKNPEMVI
YQYVDDLYVGSDLEIGQHRAKIEELRAHLLSWGFTTPDEKHQKEPPFLWMGYELHPDRWT
VQPIELPEKDSWTVNDIQKLVGKLNWASQIYAGIKVKQLCKLLRGAKALTDVVP

References
Author Title Citation
Non-B Workgroup Impact of HIV-1 subtype and antiretroviral therapy on protease and reverse transcriptase genotype: Results of a global collaboration. PLoS Med, 2005