<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
TK1014 TK1014 Denmark 2001 HIV1 D Plasma None

Treatment History
Order Regimen Weeks
1 AZT+ DDI+ RTV 22
2 AZT+ RTV+ 3TC 21
3 RTV+ 3TC+ D4T+ SQV 68
4 3TC+ D4T+ SQV+ NFV 18
5 3TC+ D4T+ NFV 13
6 ABC+ EFV+ IDV 28
7 ABC+ IDV+ D4T 47
8 ABC+ IDV+ D4T+ EFV 29

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46I, I84IV L24LI L10LV, I13V, K20I, E35D, M36I, R41K, L63P, H69K, T74S, T80TA, V82X, L89IM  
>TK1014| codons 1-99
PQITLWQRPVVTVKIGGQLIEALIDTGADDTVLEDINLPGKWKPKIIGGIGGFIKVRQYD
QIPIEICGKKAIGSVLVGPAPXNVIGRNILTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
D67N, K70R K219H K103N K238T P14PS, V35T, T39A, K43KE, V60I, D121Y, K122E, D123E, I142IV, A158AS, D177E, I178M, T200R, E203K, Q207E, R211K, V245R, D250E, A272P, K275R, Q278H, L282C, T286A, I293V, E297EK V118VG
>TK1014| codons 1-324
PISPIETVPVKLKSGMDGPKVKQWPLTEEKIKALTEICAEMEEEGKISKIGPENPYNTPI
FAIKKKNSTRWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKNKSVTVLDVGDAYFSGPL
YEEFRKYTAFTIPSINNETPGVRYQYNVLPQGWKGSPSIFQSSMTKILEPFRKQNPEMVI
YQYMDDLYVGSDLEIGQHRRKIKELREHLLKWGFTTPDHKHQKEPPFLWMGYELHPDTWT
VQPIRLPEKESWTVNDIQKLVGKLNWASQIYPGIRVKHLCKCLRGAKALTEVVPLTKEAE
LELAENREILKEPVHGVYYDPSKD

References
Author Title Citation
Non-B Workgroup Impact of HIV-1 subtype and antiretroviral therapy on protease and reverse transcriptase genotype: Results of a global collaboration. PLoS Med, 2005