<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
TK1013 TK1013 Denmark 2003 HIV1 CRF01_AE Plasma None

Treatment History
Order Regimen Weeks
1 3TC+ AZT+ EFV 61
2 3TC+ AZT+ ABC 71

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
        E6D, V35T, T39K, K43E, K122E, D123S, S162AT, K173IV, Q174K, Q207A, R211S, K238R, V245E, K249R, A272P, K277R, T286A, E291D, V292I, I293V, P294PT, E297ED, E312T, D324DE, I326V, I329V  
>TK1013| codons 1-334
PISPIDTVPVKLKPGMDGPKVKQWPLTEEKIKALTEICKEMEEEGKISKIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DESFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQASMTKILEPFRIKNPDIVI
YQYMDDLYVGSDLEIGQHRTKIEELRAHLLSWGFTTPDKKHQKEPPFLWMGYELHPDRWT
VQPIELPERDSWTVNDIQKLVGKLNWASQIYPGIKVRQLCKLLRGAKALTDIVTLTDEAE
LELAENREILKTPVHGVYYDPSKELVAEVQKQGQ

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    I13V, E35D, M36I, R41K, H69K, K70R, L89M  
>TK1013| codons 1-99
PQITLWQRPLVTVKIGGQLKEALLDTGADDTVLEDINLPGKWKPKMIGGIGGFIKVRQYD
QILIEICGKRAIGTVLVGPTPVNIIGRNMLTQIGCTLNF

References
Author Title Citation
Non-B Workgroup Impact of HIV-1 subtype and antiretroviral therapy on protease and reverse transcriptase genotype: Results of a global collaboration. PLoS Med, 2005