<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
TK1011 TK1011c Denmark 2003 HIV1 D Plasma None

Treatment History
Order Regimen Weeks
1 3TC+ AZT+ IDV 1
2 3TC+ AZT 10
3 None 17
4 3TC+ D4T+ IDV 1
5 3TC+ D4T 56
6 None 23
7 3TC+ AZT 47
8 ABC+ D4T+ DDI+ EFV 20
9 None 46
10 3TC+ AZT+ RTV+ SQV 2
11 None 1
12 3TC+ D4T+ RTV+ SQV 103

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    I13V, L19I, N37S, R41K, D60E, L63LP, I64V  
>TK1011c| codons 1-99
PQITLWQRPLVTVKIGGQIKEALLDTGADDTVLEEMSLPGKWKPKMIGGIGGFIKVRQYE
QIPVEICGHKAIGTVLVGPTPVNIIGRNLLTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M184V       V35T, T39IM, K49R, V60I, S68G, K101KQ, D121Y, K122E, I135T, Y144F, T165I, D177E, I178LM, T200I, Q207E, R211RK, V245Q, D250E, A272P, I274V, L282C, T286A, I293V, P294A, E297K  
>TK1011c| codons 1-311
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALTEICIEMEKEGKISRIGPENPYNTPI
FAIKKKDGTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLQKKKSVTVLDVGDAYFSVPL
YEDFRKYTAFTIPSTNNETPGIRFQYNVLPQGWKGSPAIFQSSMIKILEPFRKQNPELVI
YQYVDDLYVGSDLEIGQHRIKIEELREHLLKWGFTTPDKKHQKEPPFLWMGYELHPDKWT
VQPIQLPEKESWTVNDIQKLVGKLNWASQIYPGVKVKQLCKCLRGAKALTEVVALTKEAE
LELAENREILK

References
Author Title Citation
Non-B Workgroup Impact of HIV-1 subtype and antiretroviral therapy on protease and reverse transcriptase genotype: Results of a global collaboration. PLoS Med, 2005