<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
TK1010 TK1010b Denmark 2003 HIV1 A Plasma None

Treatment History
Order Regimen Weeks
1 AZT 160
2 AZT+ DDI 191
3 AZT 52
4 AZT+ 3TC 21
5 AZT+ 3TC+ IDV 156
6 IDV + Unknown 13
7 IDV+ ABC+ D4T 60
8 ABC+ D4T 13
9 ABC 83

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
  L10F T12I, I13V, G16E, E35D, M36I, R41K, R57K, I62V, L63H, H69K, K70R, L89M  
>TK1010b| codons 1-99
PQITLWQRPFVIVKIEGQLKEALLDTGADDTVLEDINLPGKWKPKMIGGIGGFIKVKQYD
QVHIEICGKRAIGTVLVGPTPVNIIGRNMLTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
D67N T215V, K219Q K101E, G190A   E6D, V35T, T39A, E40D, V60I, K122E, D123S, I135K, K173S, Q174K, D177E, V179I, Q207A, R211N, V245E, D250E, T286A, V292I, I293V, P294T, V317A, D320DE  
>TK1010b| codons 1-324
PISPIDTVPVKLKPGMDGPKVKQWPLTEEKIKALTEICADMEKEGKISKIGPENPYNTPI
FAIKKKNSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLEKKKSVTVLDVGDAYFSVPL
DESFRKYTAFTIPSKNNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRSKNPEIII
YQYMDDLYVASDLEIGQHRTKIEELRAHLLNWGFVTPDQKHQKEPPFLWMGYELHPDKWT
VQPIELPEKESWTVNDIQKLVGKLNWASQIYAGIKVKQLCKLLRGAKALTEIVTLTEEAE
LELAENREILKEPVHGAYYEPSKD

References
Author Title Citation
Non-B Workgroup Impact of HIV-1 subtype and antiretroviral therapy on protease and reverse transcriptase genotype: Results of a global collaboration. PLoS Med, 2005