<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
TK1009 TK1009 Denmark 2001 HIV1 D Plasma None

Treatment History
Order Regimen Weeks
1 AZT 56
2 AZT+ DDI 4
3 AZT+ 3TC 69
4 AZT+ 3TC+ IDV 52
5 3TC+ D4T+ NFV 30
6 EFV + ABC + RTV 95

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, T215FL   L100LI, K103N   L34I, V35T, T39M, S48T, V60I, L109LI, K122E, I142V, Q207E, R211K, L228H, V245Q, D250E, A272S, K277R, L282C, L283I, T286A, I293V, I326M, Q332P, G335D A327EQ
>TK1009| codons 1-341
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKAITEICMELEKEGKITKIGPENPYNTPI
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGIKKNKSVTVIDVGDAYFSVPL
DEDFRKYTAFTIPSINNETPGVRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVI
YQYMDDLYVGSDLEIGQHRTKIEELREHLLKWGFFTPDKKHQKEPPFHWMGYELHPDKWT
VQPIQLPEKESWTVNDIQKLVGKLNWASQIYSGIKVRQLCKCIRGAKALTEVVPLTEEAE
LELAENREILKEPVHGVYYDPSKDLMEEIQKPGQDQWTYQI

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46ML   I13V, K14KR, E35D, M36I, R41K, K45KR, R57RK, L63P, H69KQ, A71AV, L89T  
>TK1009| codons 1-99
PQITLWQRPLVTVRIGGQLKEALLDTGADDTVLEDINLPGKWKPRLIGGIGGFIKVKQYD
QIPIEICGKKVIGTVLVGPTPVNIIGRNTLTQIGCTLNF

References
Author Title Citation
Non-B Workgroup Impact of HIV-1 subtype and antiretroviral therapy on protease and reverse transcriptase genotype: Results of a global collaboration. PLoS Med, 2005