<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
TK1006 TK1006 Denmark 2000 HIV1 CRF02_AG Plasma None

Treatment History
Order Regimen Weeks
1 AZT 17
2 AZT+ DDI 26
3 AZT+ 3TC 8
4 AZT+ 3TC+ IDV 26
5 3TC+ IDV+ D4T 8
6 None 65
7 3TC+ D4T+ NFV 69
8 ABC+ EFV+ IDV+ RTV 1

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    I13V, K20I, M36I, R41K, I64IM, H69K, K70KR, L89M  
>TK1006| codons 1-99
PQITLWQRPLVTVKIGGQLIEALLDTGADDTVLEEINLPGKWKPKMIGGIGGFIKVRQYD
QILMEICGKRAIGTVLVGPTPVNIIGRNMLTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M184V       T27S, V35T, T39A, D123E, S162SA, K173KT, Q174E, D177E, I178IM, T200A, E204R, Q207E, R211K, V245Q, K275R, K277Q, T286A, E291D, V292I, I293V, P294T, L310LQ, S322A  
>TK1006| codons 1-324
PISPIETVPVKLKPGMDGPKVKQWPLSEEKIKALTEICAEMEKEGKISKIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DKEFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQASMTKILEPFRTENPEMVI
YQYVDDLYVGSDLEIGQHRAKIERLREHLLKWGFTTPDKKHQKEPPFLWMGYELHPDKWT
VQPIQLPEKDSWTVNDIQKLVGKLNWASQIYAGIRVQQLCKLLRGAKALTDIVTLTEEAE
LELAENREIQKEPVHGVYYDPAKD

References
Author Title Citation
Non-B Workgroup Impact of HIV-1 subtype and antiretroviral therapy on protease and reverse transcriptase genotype: Results of a global collaboration. PLoS Med, 2005