<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
TK1005 TK1005 Denmark 2000 HIV1 A Plasma None

Treatment History
Order Regimen Weeks
1 AZT 17
2 None 8
3 DDI 73
4 DDI+ D4T 17
5 DDI+ D4T+ RTV 4
6 D4T+ 3TC+ IDV 56
7 D4T+ 3TC+ NFV 86
8 D4T+ 3TC+ NFV+ IDV 4
9 IDV 51

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    I13V, E35D, M36I, N37ND, R41K, R57RK, L63LI, H69K, L89M  
>TK1005| codons 1-99
PQITLWQRPLVTVKIGGQLKEALLDTGADDTVLEDIDLPGKWKPKMIGGIGGFIKVKQYD
QIIIEICGKKAIGTVLVGPTPVNIIGRNMLTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
  V75VA, T215TN     K11T, K20R, V21I, V35T, T39TR, K122E, D123N, I135IT, S162SG, K173S, D177E, V179I, T200A, Q207A, R211RS, V245Q, E248D, T286A, E291D, I293V, E297K, E312D  
>TK1005| codons 1-324
PISPIETVPVTLKPGMDGPRIKQWPLTEEKIKALTEICREMEKEGKISKIGPENPYNTPV
FAIKKKDSTKWRKLADFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DENFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSPAIFQGSMTKILEPFRSQNPEIII
YQYMDDLYVGSDLEIGQHRAKIEELRAHLLSWGFNTPDKKHQKEPPFLWMGYELHPDKWT
VQPIQLPDKDSWTVNDIQKLVGKLNWASQIYAGIKVKQLCKLLRGAKALTDVVPLTKEAE
LELAENREILKDPVHGVYYDPSKD

References
Author Title Citation
Non-B Workgroup Impact of HIV-1 subtype and antiretroviral therapy on protease and reverse transcriptase genotype: Results of a global collaboration. PLoS Med, 2005