<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
TK1002 TK1002 Denmark 2000 HIV1 C Plasma None

Treatment History
Order Regimen Weeks
1 AZT+ RTV 42
2 AZT+ RTV+ 3TC 183

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46I, I54V, V82A   L10V, T12S, K14KR, I15V, L19I, K20R, M36I, R41K, Q61H, L63V, H69K, K70KR, T74S, L89M, I93L  
>TK1002| codons 1-99
PQITLWQRPVVSIRVGGQIREALLDTGADDTVLEEINLPGKWKPKIIGGIGGFVKVRQYD
HIVIEICGKRAIGSVLVGPTPANIIGRNMLTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M184V   K101E   V35T, E36A, T39E, S48T, K173T, Q174K, G196R, T200A, Q207E, R211K, V245K, E248D, D250E, A272P, K277R, T286A, E291D, V292I, I293V  
>TK1002| codons 1-324
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALTAICEEMEKEGKITKIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLEKKKSVTVLDVGDAYFSVPL
DKDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRTKNPDIVI
YQYVDDLYVGSDLEIRQHRAKIEELREHLLKWGFTTPDKKHQKEPPFLWMGYELHPDKWT
VQPIKLPDKESWTVNDIQKLVGKLNWASQIYPGIKVRQLCKLLRGAKALTDIVPLTEEAE
LELAENREILKEPVHGVYYDPSKD

References
Author Title Citation
Non-B Workgroup Impact of HIV-1 subtype and antiretroviral therapy on protease and reverse transcriptase genotype: Results of a global collaboration. PLoS Med, 2005