<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
TH_415 TH_415 Thailand 2003 HIV1 CRF01_AE Plasma None

Treatment History
Order Regimen Weeks
1 AZT+ DDI 78

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
D67N, K70R, T215F K219Q     V35T, T39K, K43E, K122E, D123S, I135L, R172K, K173M, Q174K, D177E, I178M, G196E, T200I, Q207A, R211K, L228R, K238R, V245E  
>TH_415| codons 22-253
KQWPLTEEKIKALTEICKEMEEEGKISKIGPENPYNTPVFAIKKKNSTRWRKLVDFRELN
KRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDESFRKYTAFTIPSLNNETPG
IRYQYNVLPQGWKGSPAIFQSSMTKILEPFKMKNPEMVIYQYMDDLYVGSDLEIEQHRIK
IEELRAHLLKWGFFTPDQKHQKEPPFRWMGYELHPDRWTVQPIELPEKDSWT

References
Author Title Citation
Non-B Workgroup Impact of HIV-1 subtype and antiretroviral therapy on protease and reverse transcriptase genotype: Results of a global collaboration. PLoS Med, 2005