<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
TH_410 TH_410 Thailand 2003 HIV1 CRF01_AE Plasma None

Treatment History
Order Regimen Weeks
1 AZT+ 3TC+ IDV 52

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M184V       V35T, T39R, K43E, T69S, K122E, D123S, S162C, K173T, Q174K, D177E, I178M, T200A, Q207A, R211S, V245E W239C
>TH_410| codons 18-258
GPKVKQWPLTEEKIKALTEICREMEEEGKISKIGPENPYNTPVFAIKKKDSSKWRKLVDF
RELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDESFRKYTAFTIPSINN
ETPGIRYQYNVLPQGWKGSPAIFQCSMTKILEPFRTKNPEMVIYQYVDDLYVGSDLEIGQ
HRAKIEELRAHLLSWGFTTPDKKHQKEPPFLWMGYELHPDKCTVQPIELPEKDSWTVNDI
Q

References
Author Title Citation
Non-B Workgroup Impact of HIV-1 subtype and antiretroviral therapy on protease and reverse transcriptase genotype: Results of a global collaboration. PLoS Med, 2005