<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
TH_408 TH_408 Thailand 2003 HIV1 CRF01_AE Plasma None

Treatment History
Order Regimen Weeks
1 D4T+ AZT+ DDI 78

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, L210W, T215Y D67E, V75M     V35T, T39K, K43E, E44D, V60I, S68G, V118I, K122E, D123N, K166R, K173L, Q174K, D177E, I178M, Q207A, R211N, V245E  
>TH_408| codons 18-255
GPKVKQWPLTEEKIKALTEICKELEEDGKISKIGPENPYNTPIFAIKKKEGTKWRKLMDF
RELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSIPLDENFRKYTAFTIPSINN
ETPGIRYQYNVLPQGWKGSPAIFQSSMTRILEPFRLKNPEMVIYQYMDDLYVGSDLEIGQ
HRTKIEELRAHLWNWGFYTPDKKHQKEPPFLWMGYELHPDKWTVQPIELPEKDSWTVN

References
Author Title Citation
Non-B Workgroup Impact of HIV-1 subtype and antiretroviral therapy on protease and reverse transcriptase genotype: Results of a global collaboration. PLoS Med, 2005