<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
TH_405 TH_405 Thailand 2003 HIV1 CRF01_AE Plasma None

Treatment History
Order Regimen Weeks
1 DDI+ D4T+ EFV 52

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, L210W, T215F   K101P G190R V35T, T39K, K43E, K122E, D123S, K166R, K173I, Q174K, D177E, I178M, V179L, G196E, Q207A, R211S, L228H, K238R, V245E  
>TH_405| codons 18-258
GPKVKQWPLTEEKIKALTEICKELEEEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDF
RELNKRTQDFWEVQLGIPHPAGLPKKKSVTVLDVGDAYFSVPLDESFRKYTAFTIPSINN
ETPGIRYQYNVLPQGWKGSPAIFQSSMTRILEPFRIKNPEMLIYQYMDDLYVRSDLEIEQ
HRTKIEELRAHLWSWGFFTPDKKHQKEPPFHWMGYELHPDRWTVQPIELPEKDSWTVNDI
Q

References
Author Title Citation
Non-B Workgroup Impact of HIV-1 subtype and antiretroviral therapy on protease and reverse transcriptase genotype: Results of a global collaboration. PLoS Med, 2005