<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA1824 CA4910 U.S. 1998 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 D4T 109
2 3TC+D4T+IDV 135

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46I, I84V, L90M G73T L10I, K20I, I62V, L63P, C67F, V77I  
>CA4910| codons 10-99
IVTIKIGGQLIEALLDTGADDTVLEEMNLPGRWKPKIIGGIGGFIKVRQYDQVPIEIFGH
KAITTVLIGPTPVNVIGRNLMTQIGCTLNF

References
Author Title Citation
Rhee, SY HIV-1 Protease and Reverse Transcriptase Mutations: Correlations with Antiretroviral Therapy in Subtype B Isolates and Implications for Drug-Resistance Surveillance. J Infect Dis, 2005