<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
SE638 SE638p Uganda 1998 HIV1 D Plasma None

Treatment History
Order Regimen Weeks
1 None 47

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    I13V, L33V, R41K, L63Q, I64V  
>SE638p| codons 1-99
PQITLWQRPLVTVKIGGQLKEALLDTGADDTVVEEMNLPGKWKPKMIGGIGGFIKVRQYD
QIQVEICGHKAIGTVLVGPTPVNIIGRNLLTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
        E6D, V35T, T39M, K49R, V60I, K122A, I135T, D177E, T200I, Q207E, R211K, V245K, D250E, A272P, K277R, L282C, T286A  
>SE638p| codons 1-334
PISPIDTVPVKLKPGMDGPKVKQWPLTEEKIKALTEICMEMEKEGKISRIGPENPYNTPI
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DADFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPEIVI
YQYMDDLYVGSDLEIGQHRIKIEELREHLLKWGFTTPDKKHQKEPPFLWMGYELHPDKWT
VQPIKLPEKESWTVNDIQKLVGKLNWASQIYPGIKVRQLCKCLRGAKALTEVIPLTEEAE
LELAENREILKEPVHGVYYDPSKDLIAEIQKQGQ

References
Author Title Citation
Eshleman, SH Comparison of nevirapine (NVP) resistance in Ugandan women 7 days vs. 6-8 weeks after single-dose nvp prophylaxis: HIVNET 012. ARHR, 2004