<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
AAC-DDC AACPO U.S. 1990 HIV1 B PBMC MMC

Treatment History
Order Regimen Weeks
1 DDC 80

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
T69D       R83K, I135V, T165I, A272P  
>AACPO| 16 | codons 63-279 | clone 16
IKKKDSTKWRKLVDFRELNKKTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDK
DFRKYTAFTIPSVNNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVIYQ
YMDDLYVGSDLEIGQHRTKIEELRQHLLRWGFTTPDKKHQKEPPFLWMGYELHPDKWTVQ
PIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVKQL
>AACPO| 21 | codons 63-279 | clone 21
IKKKDSDKWRKLVDFRELNKKTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDK
DFRKYTAFTIPSVNNEIPGIRYQYNVLPQGWKGSPAIFQSSMIKILEPFRKQNPDIVIYQ
YMDDLYVGSDLEIGQHRTKIEELRQHLLRWGFTTPDKEHQKEPPFLWMGYELHPDKWTVQ
PIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVKQL
>AACPO| 5 | codons 63-279 | clone 5
IKKKDSDKWRKLVDFRELNKKTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDK
DFRKYTAFTIPSVNNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVIYQ
YMDDLYVGSDLEIGQHRTKIEELRQHLLRWGFTTPDKKHQKEPPFLWMGYELHPDKWTVQ
PIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQL
>AACPO| 47 | codons 63-279 | clone 47
IKKKDSDKWRKLVDFRELNKKTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDK
DFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMIKILEPFRKQNPDIVIYQ
YMDDLYVGSDLEIGQHRTKIEELRQHLLRWGFTTPDKKHQKEPPFLWMGYELHPDKWTVQ
PIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVKQL
>AACPO| 41 | codons 63-279 | clone 41
IKKKDSDKWRKLVDFRELNKKTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDK
DFRKYTAFTIPSVNNETPGIRYQYNVLPQGWKGSPAIFQSSMIKILEPFRKQNPDIVIYQ
YMDDLYVGSDLEIGQHRTKIEELRQHLLRWGFTTPDKKHQKEPPFLWMGYELHPDKWTVQ
PIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVKQL
>AACPO| 32 | codons 63-279 | clone 32
IKKKDSDKWRKLVDFRELNKKTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDK
DFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVIYQ
YMDDLYVGSDLEIGQHRTKIEELRQHLLKWGFTTPDKKHQKEPPFLWMGYELHPDKWTVQ
PIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVKQL
>AACPO| 30 | codons 63-279 | clone 30
IKKKDSDKWRKLVDFRELNKKTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDE
DFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVIYQ
YVDDLYVGSDLEIGQHRTKIEELRQHLLRWGFTTPDKKHQKEPPFLWMGYELHPDKWTVQ
PIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVKQL
>AACPO| 25 | codons 63-279 | clone 25
IKKKDSDKWRKLVDFRELNKKTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDK
DFRKYTAFTIPSVNNETPGIRYQYNVLPQGWKGSPAIFQSSMIKILEPFRKQNPDIVIYQ
YMDDLYVGSDLEIGQHRTKIEELRQHLLRWGFTTPDKKHQKEPPFLWMGYELHPDKWTVQ
PIALPKKDSWTVNDIQKLVGKLNWASQIYPGIKVKQL
>AACPO| 12 | codons 63-279 | clone 12
IKKKDSDKWRKLVDFRELNKKTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDK
DFRKYTAFTIPSVNNETPGIRYQYNVLPQGWKGSPAIFQSSMIKILEPFRKQNPDIVIYQ
YMDDLYVGSDLEIGQHRTKIEELRQHLLRWGFTTPDKKHQKEPPFLWMGYELHPDKWTVQ
PIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVKQL
>AACPO| 28 | codons 63-279 | clone 28
IKKKDSDKWRKLVDFRELNKKTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDK
DFRKYTAFTIPSVNNEIPGIRYQYNVLPQGWKGSPAIFQSSMIKILEPFRKQNPDIVIYQ
YMDDLYVGSDLEIGQHRTKIEELRQHLLRWGFTTPDKEHQKEPPFLWMGYELHPDKWTVQ
PIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVKQL
>AACPO| 18 | codons 63-279 | clone 18
IKKKDSDKWRKLVDFRELNKKTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDE
DFRKYTAFTIPSVNNETPGIRYQYNVLPQGWKGSPAIFQSTMTKILEPFRKQNPDIVIYQ
YMDDLYVGSDLEIGQHRTKIEELRQHLLRWGFTTPDKKHQKEPPFLWMGYELHPDKWTVQ
PIVLPEKDSWTVNDI*KLVGKLNWASQIYPGIKVKQL
>AACPO| codons 63-279
IKKKDSDKWRKLVDFRELNKKTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDK
DFRKYTAFTIPSVNNETPGIRYQYNVLPQGWKGSPAIFQSSMIKILEPFRKQNPDIVIYQ
YMDDLYVGSDLEIGQHRTKIEELRQHLLRWGFTTPDKKHQKEPPFLWMGYELHPDKWTVQ
PIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVKQL

References
Author Title Citation
Fitzgibbon, JE Human immunodeficiency virus type 1 pol gene mutations which cause decreased susceptibility to 2',3'-dideoxycytidine. AAC, 1992
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005