<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
DMP004-135 04-135055 U.S. 1995 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 AZT+ 3TC NA
2 AZT+ 3TC+ EFV 8

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
K70R, M184V N348I K103N   T27TI, E169D, K173Q, T200A, F214L, V245T, D250E, A272P, K277R, I293V, G335D, T338S, R356K, M357T, A360AV, A376T  
>04-135055| codons 1-399
PISPIETVPVKLKPGMDGPKVKQWPLIEEKIKALVEICTEMEKEGKISKIGPENPYNTPV
FAIKKKDSTRWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKNKSVTVLDVGDAYFSVPL
DKDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILDPFRQQNPDIVI
YQYVDDLYVGSDLEIGQHRAKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWT
VQPITLPEKESWTVNDIQKLVGKLNWASQIYPGIKVRQLCKLLRGTKALTEVVPLTEEAE
LELAENREILKEPVHGVYYDPSKDLIAEIQKQGQDQWSYQIYQEPFKILKTGKYAKTRGV
HTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWE

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    R41K, I64V, K70R  
>04-135055| codons 1-99
PQITLWQRPLVTIKIGGQLKEALLDTGADDTVLEEMNLPGKWKPKMIGGIGGFIKVRQYD
QILVEICGHRAIGTVLVGPTPVNIIGRNLLTQIGCTLNF

References
Author Title Citation
Bacheler, LT Genotypic correlates of phenotypic resistance to efavirenz in virus isolates from patients failing nonnucleoside reverse transcriptase inhibitor therapy. J Virol, 2001
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005