<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
DMP004-132 04-132000 U.S. 1995 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 AZT+ 3TC NA

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, T69D, K70R, M184V, T215F K219Q     V90VI, K104KR, K122E, D123E, I135T, K154KE, G196E, L228H, T286TA, V317VA, I326V, Q334IV, R356K, G359S, A360T, T377Q, K390R  
>04-132000| codons 1-399
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTELEKEGKISKIGPENPYNTPV
FAIKKKNSDRWRKLVDFRELNKRTQDFWEIQLGIPHPAGLKKKRSVTVLDVGDAYFSVPL
DEEFRKYTAFTIPSTNNETPGIRYQYNVLPQGWEGSPAIFQSSMTKILEPFRKQNPDIVI
YQYVDDLYVGSDLEIEQHRTKIEELRQHLLRWGFFTPDQKHQKEPPFHWMGYELHPDKWT
VQPIVLPEKDSWTVNDIQKLVGKLNWASQIYAGIKVKQLCKLLRGAKALTEVIPLTEEAE
LELAENREILKEPVHGAYYDPSKDLVAEIQKQGIGQWTYQIYQEPFKNLKTGKYAKMRST
HTNDVKQLTEAVQKIAQESIVIWGKTPKFRLPIQKETWE

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    L10I, T12I, I13V, G16E, M36I, I62V, L63A  
>04-132000| codons 1-99
PQITLWQRPIVIVKIEGQLKEALLDTGADDTVLEEINLPGRWKPKMIGGIGGFIKVRQYD
QVAIEICGHKAIGTVLVGPTPVNIIGRNLLTQIGCTLNF

References
Author Title Citation
Bacheler, LT Genotypic correlates of phenotypic resistance to efavirenz in virus isolates from patients failing nonnucleoside reverse transcriptase inhibitor therapy. J Virol, 2001
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005