<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
DMP004-121 04-121251 U.S. 1995 HIV1 B PBMC None

Treatment History
Order Regimen Weeks
1 AZT+ 3TC NA
2 AZT+ 3TC+ EFV 36

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, M184V, T215Y   K103N V108I K102Q, K122E, I135V, I142V, S162C, E169D, I202X  
>04-121251| codons 1-229
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTELEKEGKISKIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKQNKSVTILDVGDAYFSVPL
DEDFRKYTAFTIPSVNNETPGVRYQYNVLPQGWKGSPAIFQCSMTKILDPFRKQNPDIVI
YQYVDDLYVGSDLEIGQHRTKMEELRQHLLRWGFYTPDKKHQKEPPFLW

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    L63P, V77I, Q92R, I93L  
>04-121251| codons 1-99
PQITLWQRPLVTIKIGGQLKEALLDTGADDTVLEEMNLPGRWKPKMIGGIGGFIKVRQYD
QIPIEICGHKAIGTVLIGPTPVNIIGRNLLTRLGCTLNF

References
Author Title Citation
Bacheler, LT Genotypic correlates of phenotypic resistance to efavirenz in virus isolates from patients failing nonnucleoside reverse transcriptase inhibitor therapy. J Virol, 2001
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005