<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
DMP004-107 04-107149 U.S. 1995 HIV1 B PBMC None

Treatment History
Order Regimen Weeks
1 AZT+ 3TC NA
2 AZT+ 3TC+ EFV 21

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, M184V, T215FS   Y188L   K20KR, K22KN, D123E, K166KR, D177DE T7LP
>04-107149| codons 5-229
IELVPVKLKPGMDGPRVNQWPLTEEKIKALVEICTELEKEGKISKIGPENPYNTPVFAIK
KKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDKEF
RKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTRILEPFRKQNPEIVIYQYV
DDLLVGSDLEIGQHRTKIEELRQHLLRWGFFTPDKKHQKEPPFLW

References
Author Title Citation
Bacheler, LT Genotypic correlates of phenotypic resistance to efavirenz in virus isolates from patients failing nonnucleoside reverse transcriptase inhibitor therapy. J Virol, 2001
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005