<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA1817 CA4874 U.S. 1998 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 None 52

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
L90M   L10I, I13V, K20T, R57RK, L63A, A71V  
>CA4874| codons 1-99
PQITLWQRPIVTVKIGGQLTEALLDTGADDTVLEEMNLPGRWKPKMIGGIGGFIKVKQYD
QIAIEICGHKVIGTVLVGPTPVNIIGRNLMTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L       V118VI, I135V, S162C, Q207E, R211K, T215X, V245K, A272P, Q278QH, T290X, I293V N265NT, K281KE, K287KI
>CA4873| codons 1-302
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTELEKEGKISKIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSIPL
DKDFRKYTAFTIPSVNNETPGIRYQYNVLPQGWKGSPAIFQCSMTKILEPFRKQNPDIVI
YQYMDDLYVGSDLEIGQHRTKIEELREHLLKWGFXTPDKKHQKEPPFLWMGYELHPDKWT
VQPIKLPEKDSWTVNDIQKLVGKLTWASQIYPGIKVKHLCELLRGTIALXEVVPLTEEAE
LE

References
Author Title Citation
Gonzales, MJ HIV-1 reverse transcriptase and protease subtypes: Classification, amino acid mutation patterns, and prevalence in a northern California clinic-based population. J Infect Dis, 2001