<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
VL99SN133HALD 99SN133 Africa 1999 HIV1 CRF02_AG Plasma None

Treatment History
Order Regimen Weeks
1 None NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    L10I, I13V, I15L, K20I, M36I, R41K, L63V, H69K, L89M  
>99SN133| codons 1-99
PQITLWQRPIVTVKLGGQLIEALLDTGADDTVLEEINLPGKWKPKMIGGIGGFIKVRQYD
QIVIEICGKKAIGTVLVGPTPVNIIGRNMLTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
        V35T, E36D, T39A, D123E, I135L, S162A, K173T, Q174K, D177E, T200A, Q207E, V245K, I257V, T286A, E291D, V292I, I293V, P294T, L295M, S322T, I326V, G335D, R356K, M357K, R358K, G359C, A371V, I375V, A376S, T386I, K390R, Y427S, E432D Y146L
>99SN133| codons 1-433
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALTDICAEMEKEGKISKIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DKEFRKYTAFTIPSLNNETPGIRYQLNVLPQGWKGSPAIFQASMTKILEPFRTKNPEIVI
YQYMDDLYVGSDLEIGQHRAKIEELREHLLRWGFTTPDKKHQKEPPFLWMGYELHPDKWT
VQPIKLPEKDSWTVNDVQKLVGKLNWASQIYAGIKVKQLCKLLRGAKALTDIVTMTEEAE
LELAENREILKEPVHGVYYDPTKDLVAEIQKQGQDQWTYQIYQEPFKNLKTGKYAKKKCA
HTNDVKQLTEVVQKVSTESIVIWGKIPKFRLPIQKETWEAWWTEYWQATWIPEWEFVNTP
PLVKLWSQLEKDP

References
Author Title Citation
Vergne, L Low rate of genotypic HIV-1 drug-resistant strains in the Senegalese government initiative of access to antiretroviral therapy. AIDS, 2003