<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
VL98SN53HALD 98SN53 Africa 1998 HIV1 CRF02_AG Plasma None

Treatment History
Order Regimen Weeks
1 AZT+ DDI NA

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
K65R       V35T, E36A, T39E, S48T, K122E, D123N, K173A, D177E, T200A, Q207N, V245Q, D250G, A272P, K277R, T286A, E291D, V292I, I293V, I329L, G335D, R356K, G359T, A376T, T377M, T386A, A400T, T403M, E404D, E432D, D443N  
>98SN53| codons 1-445
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALTAICEEMEKEGKITKIGPENPYNTPV
FAIKRKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DENFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRAQNPEIVI
YQYMDDLYVGSDLEIGQHRAKIEELRNHLLRWGFTTPDKKHQKEPPFLWMGYELHPDKWT
VQPIQLPEKGSWTVNDIQKLVGKLNWASQIYPGIKVRQLCKLLRGAKALTDIVPLTEEAE
LELAENREILKEPVHGVYYDPSKDLIAELQKQGQDQWTYQIYQEPFKNLKTGKYAKMRTA
HTNDVKQLTEAVQKITMESIVIWGKAPKFKLPIQKETWETWWMDYWQATWIPEWEFVNTP
PLVKLWYQLEKDPIVGAETFYVNGA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    K14R, E35D, M36I, R41K, R57K, H69K, L89M  
>98SN53| codons 1-99
PQITLWQRPLVTIRIGGQLKEALLDTGADDTVLEDINLPGKWKPKMIGGIGGFIKVKQYD
QILIEICGKKAIGTVLVGPTPVNIIGRNMLTQIGCTLNF

References
Author Title Citation
Vergne, L Low rate of genotypic HIV-1 drug-resistant strains in the Senegalese government initiative of access to antiretroviral therapy. AIDS, 2003